Везикулярный транспорт: Гликопротеины, переносимые из шероховатого эндоплазматическо­го

Везикулярный транспорт. Двигательные органеллы клетки

Везикулярный транспорт: Гликопротеины, переносимые из шероховатого эндоплазматическо­го

Студенты, аспиранты, молодые ученые, использующие базу знаний в своей учебе и работе, будут вам очень благодарны.

Размещено на http://www.allbest.ru/

Карагандинский Государственный Медицинский Университет

Кафедра молекулярной биологии и медицинской генетики

РЕФЕРАТ

на тему: «Везикулярный транспорт. Двигательные органеллы клетки»

Выполнила: Абдульманова Сауле

Проверил: Бритько В. В.

Караганда 2014г.

fПлан

1. Открытие механизмов везикулярного аппарата

2. Везикулярный транспорт

3. Двигательные органеллы клетки

f1. Открытие механизмов везикулярного транспорта

7 октября 2013г. американские ученые Рэнди Шекман и Джеймс Ротман и исследователь из Германии Томас Зюдхоф были награждены Нобелевской премией по медицине и физиологии 2013 года.

Рэнди Шекман изучил гены, кодирующие регуляторные белки везикулярного транспорта. Он работал с моделью дрожжевых клеток. Именно при сравнении нормальных и мутировавших клеток дрожжей, в которых везикулярный транспорт был полностью нарушен, Рэнди Шекман определил гены, участвующие в регуляции транспорта молекул к поверхности клетки и к внутриклеточным компартментам.

Джеймс Ротман открыл белковый комплекс в составе оболочки везикул, позволяющий везикуле сливаться с таргетной мембраной. Протеины в составе везикул, комплементарно связываясь с протеинами на таргетной мембране, позволяют везикулам сливаться с мембраной в нужном месте и доставлять транспортные молекулы по назначению.

fТомас Зюдхоф изучил вопрос, каким образом передаются сигналы между нейроцитами в головном мозге и как ионы кальция участвуют в регуляции этих процессов. Ученый идентифицировал молекулярную «машину», чувствительную к концентрации ионов Ca2+, и являющуюся триггером сливания везикул с мембраной. Так мы получили объяснение того, как по команде сигнальные молекулы высвобождаются из везикул.

Нарушения везикулярного транспорта – базового клеточного процесса, приводит к различным последствиям в зависимости от функциональной направленности клетки (нейроны, клетки эндо- и экзокринных желез). Возможно, в будущем, научившись выявлять эти нарушения на клеточном уровне, мы сможем целенаправленно воздействовать на эти механизмы.

2. Везикулярный транспорт

Синтез белка всегда начинается в цитоплазме. Окончание синтеза происходит в цитоплазме либо на шероховатом эндоплазматическом ретикулуме (ШЭР).

Можно условно выделить два пути транспорта белка в клетке:

1. Из цитоплазмы в некоторые органеллы (ядро, пластиды, митохондрии)

2. Большой путь везикулярного транспорта из ШЭР через аппарат Гольджи (АГ) к другим органеллам (лизосомы, пероксисомы) и через секреторные везикулы во внеклеточную среду.

Поскольку синтез всех белков начинается в цитоплазме, а конечная локализация каждого белка может быть различна внутри полипептида имеется система сигналов определяющая его транспортный путь.

Первичный сигнал определяет путь из цитоплазмы, вторичный сигнал определяет дальнейшее направление, например, внешняя или внутренняя мембрана митохондрии или матрикс; лизосома, пероксисома или секреторная гранула.

fПути транспорта белков в клетке

Синтез белка всегда начинается в цитоплазме. Окончание синтеза происходит в цитоплазме либо на шероховатом эндоплазматическом ретикулуме (ШЭР).

Можно условно выделить два пути транспорта белка в клетке:

1. Из цитоплазмы в некоторые органеллы (ядро, пластиды, митохондрии)

2. Большой путь везикулярного транспорта из ШЭР через аппарат Гольджи (АГ) к другим органеллам (лизосомы, пероксисомы) и через секреторные везикулы во внеклеточную среду.

Поскольку синтез всех белков начинается в цитоплазме, а конечная локализация каждого белка может быть различна внутри полипептида имеется система сигналов определяющая его транспортный путь.

Первичный сигнал определяет путь из цитоплазмы (в ШЭР, в ядро, в митохондрию или в пластиду), вторичный сигнал определяет дальнейшее направление, например, внешняя или внутренняя мембрана митохондрии или матрикс; лизосома, пероксисома или секреторная гранула.

Везикулярный транспорт

Из одной органеллы в другую перемещение происходит в везикуле или на ее поверхности в виде интегральных белков.

Донорый компартмент – органелла от которой отрывается мембрана в составе везикулы, акцепторный компартмент – принимает везикулу.

конститутивная секреция – происходит постоянно и не зависит от внешних сигналов.

регулируемая секреция – под ПМ происходит накопление пузырьков, которые сливаются с ПМ при наличии внешних сигналов – гормоны, нервы – и повышении конц. Ca2+ до 1мкм

ретроградный транспорт – возвращение рецепторных белков и липидов из АГ в Эр – восполнение мембраны ЭР.

антероградный транспорт – растворимые грузовые белки двигаются по секреторному пути ЭР. Окаймленные везикулы – покрыты белками, кот узнают и концентрируют специфич. м-ные белки и отделяют м-ну пузырька, формируют решетку и придают форму везикуле: клатриновые, COPI, COPII:

Клатриновые везикулы – ~0,1мкм, транспорт из АГ и ПМ,клатрин – 3типа, 3 большие и 3 малые субъединицы формирующие трискелетон – собирающиеся на поверхности м-ны со стороны цитоплазмы в пента- и гексагоны, кот спонтанно формируют сферу. Адаптин – связывает клатрин с м-ной и ловит различные трансм-ные белки в том числе грузовые рецепторы, кот.

захватывают р-римые грузовые белки, кот попадают внутрь везикулы.

Имеетя по крайней мере 4 типа адаптинов динамин – GTP-аза, р-римый цитоплазматический белок, образует кольцо на отделяющейся клатриновой везикуле – регулирует кол-во клатрина отщепляющееся вместе с м-ной в составе везикулы, ассоциирует другие белки помогающие выпучить м-ну и белки модификаторы липидов, изменяющие локально липидный состав м-ны для выпучивания

После отделения везикулы от м-ны клатрин и адипин отделяют шапероны – ATP-азы hsp70 семейства. Ауксилин – прикрепляется к везикуле и активирует АТФ-азу. Т.к кайма формирующейся везикулы сущ.

дольше чем кайма отделенной – имеется стабилизирующий механизм. Клатриновая оболочка обеспечивает значительную силу для изгибания м-ны, т.к.

везикулы из внутриклеточных компартментов образуются на уже выпученной м-не

COP-I – транспорт от АГ и ЭР, 8субъединиц, GTP-белок – фактор рибозилирования АДФ -ARF – транспорт

COP-II – транспорт из АГ и ЭР, 5 субъединиц

Везикулы мб не только сферические, часто образуются трубчатые везикулы в которых высокое соотношение S/V

Образование клатриновых и COP везикул регулируется GTP-связывающими белками, которые могут находится в активном GTP- и неактивном GDP-состоянии

Два класса белков обменивают GDP-GTP:

GEF-гуанин-нуклеотид-фактор обмена активирует белки заменяя GDF/GTF, GAP- белок активирующий GTP-азы – инактивирует GTP-связывающие белки меняя GTP?GDP.

GTP-азы необходимые для сборки окаймленных везикул перед сборкой пузырьков: мономерные GTP-связывающие белки (GTP-азы):

ARF-белки – необх для клатриновой и COP сборки на пов-ти м-ны АГ. Sar1 белок, необходим для COPII сборки на на ЭР м-не

тримерные (G белки).

GTP-азы находятся в цитозоле в неактивном состоянии, перед сборкой GEF встраивается в м-ну ЭР и связывает цитозольный SarI, кот обменивает GDF?GTP. В GTP состоянии SarI встраивается остатком жирной к-ты в м-ну ЭР.

Ассоциирует белки об-ки и инициирует отпочковывание везикулы. GTP-азы попавшие в м-ну активируют фосфолипазу D, кот преобразует фосфолипиды в фосфотидную к-ту, что усиливает связывание оболочных белков.

Вместе белок-белковые и белок-липидные взаимодействия изгибают м-ну

SNARE – белки – отвечают за слияние донорной и акцепторной м-н, более 20, каждая на специфич пов-ти м-ны, трансмембранные белки на пов-ти везикулы – v-SNAR, на пов-ти донора – t-SNAR.

Взаимодействуя v- и t-SNAR обвиваются др на друга в транс-SNAR-комплекс, обеспечивающий слияние м-н.

SNF-белок разрушает транс-SNAR-комплексы – цитозольный шаперон ATP-аза, использует адаптирующие белки для связывания с комплексом-SNAR

Rab-белки – мономерные GTP-азы, более 30, каждая органелла имеет хотя бы один Rab на м-не со стороны цитоплазмы, регулируют стыковку везикул и связывание v-SNAR-ов и t-SNAR-ов необходимых для слияния м-н.

В состоянии GDP-не активны, нах в цитозоле, в состоянии GTP-активны и переходят на пов-ть м-ны органеллы или везикулы.

В активном состоянии Rap связываются с м-ной липидным якорем и собирают другие белки участвующие в слиянии м-н неактивный Rab-GDP связан с GDI – GDP-диссоциирующий ингибитор.

Rab-GDP связывается с GEF-гуанин нуклеотид меняющий фактор, связанный с м-ной донорного компартмента – меняет GDP на GTP. Rab-GTP связывается с м-ной формирующейся везикулы и ассоциирует v-SNARE, которые в составе везикулы транспортируются к органелле и связываются с Rab-эффекторами и t-SNARE, связанными с м-ной акцепторного компартмента и обеспечивают слияние м-н

белок органелла

Rab1 ЭР и АГ

Rab2 цис-АГ

Rab3A синаптич везикулы, секрет гранулы

Rab4 ранние эндосомы

Rab5A ПМ, клатриновые везикулы

Rab5C ранние эндосомы

Rab6 промежуточный- и транс-АГ

Rab7 поздние эндосомы

Rab8 секреторные везикулы (базолатеральные)

Rab9 поздние эндосомы, trans-АГ

Слияние м-н происходит не только при везикулярном транспорте: слияние спермия с яйцом, слияние миобластов во время развития мышечной клетки.

Образование клатринового пузырька. Диаметр клатринового пузырька ~0,3 мкм

Клатриновая везикула

Сложная организация эукариотических клеток требует налаженных механизмов внутриклеточного везикулярного транспорта.

Новейшие исследования показали, что механизмы, лежащие в основе таких функционально важных процессов как эндо- и экзоцитоз уникальны и, сохранившись в процессе эволюции, эффективно действуют как в клетке дрожжей, так и в нейроне гиппокампа.

Как эндоцитоз лиганд-рецепторного комплекса с поверхности плазматической мембраны, так и транспорт вновь синтезируемых секреторных белков из эндоплазматического ретикулума через цис-, медиал-, транс- Гольджи к поверхности плазматической мембраны осуществляются в везикулах.

Транспортные везикулы формируются и отпочковываются от донорной мембраны и после осуществления раунда внутриклеточного транспорта сливаются с акцепторной мембраной. Специализированные белки цитоплазмы покрывают вновь образованные везикулы.

Согласно современным представлениям, формирование транспортной везикулы на мембране внутриклеточного компартмента начинается после взаимодействия белков, переносимых везикулой, с трансмембранным рецептором. Изменение структурного состояния связанного рецептора может распознаваться цитоплазматическими белками, которые ассоциируются с мембраной и инициируют образование транспортной везикулы.

Транспорт белков из аппарата Гольджи на наружную мембрану

Белки, встроившиеся в мембрану ЭПС и попавшие оттуда в составе везикул в АГ, могут перемещаться на наружную мембрану клетки. Их направление к мембране осуществляется благодаря взаимодействию везикул с микротрубочками цитоскелета и благодаря особым стыковочным белкам, которые обеспечивают слияние везикул с мембраной

Экзоцитоз и трансцитоз

Экзоцитоз есть как у эукариот, так иу прокариот. Экзоцитоз (от греч. ёощ — внешний и кэфпт — клетка) у эукариот — клеточный процесс, при котором внутриклеточные везикулы (мембранные пузырьки) сливаются с наружной клеточной мембраной.

При экзоцитозе содержимое секреторных везикул (экзоцитозных пузырьков) выделяется наружу, а их мембрана сливается с клеточной мембраной. Практически все макромолекулярные соединения (белки, пептидные гормоны и др.

) выделяются из клеток эукариот этим способом.

У прокариот везикулярный механизм экзоцитоза не встречается, у них экзоцитозом называют встраивание белков в клеточную мембрану (или в наружную мембрану у грамотрицательных бактерий), выделение белков из клетки во внешнюю среду или в периплазматическое пространство.

Экзоцитоз может выполнять различные задачи:

доставка на клеточную мембрану липидов, необходимого для роста клетки;

доставка на клеточную мембрану мембранных белков, таких как рецепторы или белки-транспортёры. При этом часть белка, которая была направлена внутрь секреторной везикулы, оказывается выступающей на наружной поверхности клетки;

выделение различных веществ из клетки; это могут быть, например, непереваренные остатки пищи у фаготрофных протистов, пищеварительные ферменты у животных с полостным пищеварением, белки межклеточного вещества у животных и материал клеточной стенки у растений, сигнальные молекулы (гормоны или нейромедиаторы).

У эукариот различают два типа экзоцитоза: Кальций-независимый конститутивный экзоцитоз встречается практически во всех эукариотических клетках. Это необходимый процесс для построения внеклеточного матрикса и доставки белков на внешнюю клеточную мембрану. При этом секреторные везикулы доставляются к поверхности клетки и сливаются с наружной мембраной по мере их образования.

Кальций-зависимый неконститутивный экзоцитоз встречается, например, в химических синапсах, где служит для выделения нейромедиаторов.

При этом типе экзоцитоза секреторные пузырьки накапливаются в клетке, а процесс их высвобождения запускается по определённому сигналу, опосредованному быстрым повышением концентрации ионов кальция в цитозоле клетки.

В пресинаптических мембранах процесс осуществляется специальным кальций-зависимым белковым комплексом.

везикулярный транспорт белок клетка

3. Двигательные органеллы клетки

Нaряду c тaкими жизнeнно вaжными процессaми клeтки как рoст, рaзвитиe, обмен веществ, клетка способна перемещаться, передвигать органеллы в цитоплазме и разделять хромосомы во время митоза. Это спoсoбнoсть oбeспечивaeтcя двигaтeльными oрганеллами клетки и цитоскелетом.

Цитoскeлет — это клетoчный каркaс или скелeт, находящийся в цитoплазме эукариот и у прокариот. В цитоскелете выделяют несколько основных систем: микрофилaменты, промежуточные филаменты, микротрубочки.

К двигательным oрганeллaм относятся жгутики, рeснички, микроворсинки.

Цитоскелет образован белками. В цитоскелете выделяют несколько основных систем, называемых либо по основным структурным элементам, заметным при электронно-микроскопических исследованиях (микрофиламенты, промежуточные филаменты, микротрубочки), либо по основным белкам, входящим в их состав. (актин-миозиновая система, кератины, тубулин-линейновая система).

f(Актиновые филаменты окрашены в красный цвет; микротрубочки – в зеленый цвет)

Микротрубочки вхoдят в состaв как времeнных, так и постoянных структур клетки. К времeнным относится веретeно делeния, а к постoянным – рeснички, жгутики и цeнтриоли клеточнoго центра. Микрoтрубочки- это прямыe пoлые цилиндры с диaметром окoлo 24 нм, их стeнки обрaзованы oкруглыми мoлекулами бeлка тубулинa.

Под элeктрoнными микрoскопом виднo, что сечeние микрoтрубoчки обрaзовaно 13 субъeдиницaми, соединeнными в кoльцо. Однa из функций микротрубoчек – созданиe кaркаса внутри клeток. Кромe того, по микрoтрубочкaм, как по рельсaм, перемещaются мeлкие вeзикулы. Микрoтрубочки регулируют расхождение хромосом по полюсам.

Микротрубочки в клетке используются в качестве «рельсов» для транспортировки частиц. По их поверхности могут перемещаться мембранные пузырьки и митохондрии. Транспортировку по микротрубочкам осуществляют белки, называемые моторными.

Это высокомолекулярные соединения, состоящие из двух тяжёлых (массой около 300 кДа) и нескольких лёгких цепей. В тяжёлых цепях выделяют головной и хвостовой домены.

Два головных домена связываются с микротрубочками и являются собственно двигателями, а хвостовые — связываются с органеллами и другими внутриклеточными образованиями, подлежащими транспортировке.

Веретено деления – структура, возникающая в клетках эукариот в процессе деления ядра. Получила своё название за отдалнное сходство формы с веретеном. Состоит из микротрубочек.

(Веретено деления. Раняя фаза митоза)

Клеточный центр (центросома). В клеткaх живoтных вблизи ядра нахoдится органoид, котoрый назывaют клетoчным цeнтром. Оснoвную чaсть клетoчного центра состaвляют два мaленьких тельцa – цeнтриоли, распoлoжeнные в небoльшом учaстке уплoтненной цитoплaзмы. Центриoли игрaют вaжную роль при дeлении клeтки; они учaствуют в обрaзовании верeтена дeления.

Увидели центросому в 1887 г. ее первооткрыватели: Т.Бовери описал ее в полюсах митотического веретена, а Э.ван Бенеден – в интерфазной клетке.

Центриоли – это мeлкие пoлые цилиндры (длиной 0,3-0,5 мкм и около 0,2 мкм в диаметрe), встречающиeся в виде пaрных структур почти во всeх животных клеткaх. Каждaя цeнтриоль пострoeна из дeвяти триплeтов микрoтрубочeк. Эти оргaнeллы в дeлящихся клеткaх принимaют учaстие в формирoвании веретeна делeния.

(Центриоль из 9 триплетов микротрубочек)

Реснички и жгутики идeнтичны по своeму стрoeнию, но жгутики длиннee ресничeк. Обе эти органeллы предстaвляют собoй вырoсты клeток. Движутся они либо однонaправленно (биeние рeсничек), либо вoлнообразно (движения жгутиков).

Служaт рeснички и жгутики как для передвижeния отдeльных клетoк, так и для того, чтобы перегoнять жидкoсть вдоль поверхнoсти клеток (так перегoняют рeснички слизь в дыхатeльных путях).

В основaнии кaждой рeснички и жгутикa всегдa обнaруживaется базaльное тeльце.

Реснички трахеи Реснички в разрезе

Микроворсинки – пальцeвидные вырoсты плазмaтической мeмбраны некoторых живoтных клeток.

Иногда микрoворсинки увеличивaют площaдь повeрхности клeтки в 25 раз, поэтoму oни особeнно многoчисленны на повeрхности клeток всaсывающего типа, а имeнно в эпитeлии тонкогo кишeчника и извитых канaльцев нефрoнов.

Это увeличение площaди всасывaющей повeрхности спосoбствует и лучшeму перевaриванию пищи в кишeчнике, потому что некоторыe пищевaрительные фермeнты нахoдятся на повeрхности клеток и связaны с ней.

Строение жгутика

Цитоскелет — это клетoчный кaркас или скелет, находящийся в цитоплазме эукариот и у прокaриот. В цитоскелете выдeляют нескoлько oсновных систeм, называeмых либo по оснoвным структурным элементам (микрофилaменты, промeжуточные филамeнты, микрoтрубoчки), либo по оснoвным белкaм (aктин-миoзиновая систeма, керaтины, тубулин-динeинoвая систeмa).

Промежуточные филаменты придaют прoчность клетке. Микрофиламенты обуслaвливают двигaтeльные функции клeтки. Микрoтрубочки регулируют расхождение хромосом по полюсам. Реснички и жгутики движутся однонaправленно или вoлнообразно.

Служaт рeснички и жгутики как для передвижeния отдeльных клетoк, так и для того, чтобы перегoнять жидкoсть вдоль поверхнoсти клеток (так перегoняют рeснички слизь в дыхатeльных путях).

Размещено на Allbest.ru

Источник: https://revolution.allbest.ru/biology/00463401_0.html

Нобелевская премия по физиологии и медицине (2013): везикулярный транспорт

Везикулярный транспорт: Гликопротеины, переносимые из шероховатого эндоплазматическо­го

Живая клетка напоминает огромный порт, в котором тысячи единиц груза одновременно прибывают и распределяются в другие порты и на склады.

Этот груз транспортируется с помощью микроскопических мембранных пузырьков — везикул.

В 2013 году Нобелевскую премию по физиологии и медицине вручили Джеймсу Ротману, Рэнди Шекману и Томасу Зюдофу — «за открытие системы везикулярного транспорта — основной транспортной системы в наших клетках».

Эукариотические клетки отличаются от прокариот более сложной внутриклеточной организацией, характерной наличием не только клеточного ядра, но и большого количества мембранных органелл — «пузырьков», стенки которых состоят из липидной бислойной мембраны.

Собственно, и само ядро можно представить большим пузырьком, играющим роль генетического центра в клетке.

В более общем виде это носит название принципа компартментализации: когда внутренность клетки представляет собой не единый мешок (как у бактерий), а совокупность отсеков, в каждом из которых выполняется своя работа, направленная на всеобщее благо.

Разбиение клетки на компартменты сильно повышает эффективность клеточных процессов и не дает многим опасным молекулам «плавать» на свободе. Но это создает и проблему коммуникации: очевидно, что компартменты внутри клеток (как и клетки между собой) должны обмениваться веществом — сигнальными молекулами, «строительным материалом», «импортом» и «экспортом» (рис. 1).

Рисунок 1. Везикулярный транспорт. Каждая клетка нашего организма сложно устроена, и масса важных функций выполняется внутри специальных органелл, «одетых» общей клеточной мембраной. Молекулы, производимые в клетке, «упаковываются» в специальные мембранные пузырьки (везикулы) и доставляются точно вовремя и точно по адресу — будь то та же самая или другая клетка.

Мистика клеточной компартментализации волновала ученых с давних пор (и волнует до нынешнего времени).

Совершенствование световой микроскопии легко и наглядно показало отличие эукариотической клетки от бактерий, однако с развитием электронной микроскопии и технологий подготовки биологических образцов внутренний мир клетки буквально ошеломил ученых своим ювелирным устройством.

Пионерами этого удивительного мира стали лауреаты Нобелевской премии по физиологии и медицине 1974 года Альбер Клод, Джордж Паладе и Кристиан Де Дюв, подробно исследовавшие внутреннее устройство клетки.

Еще раньше Камилло Гольджи открыл названный его именем аппарат Гольджи, служащий «шлюзом» для секретируемых клеткой белков (он также был удостоен в 1906 году Нобелевской премии по физиологии и медицине). Наконец, в 1999-м году Нобелевская премия была вручена Гюнтеру Блобелю, открывшему сигнальные последовательности в белках, играющие роль «бирок с адресом».

Однако все это оставляло еще один вопрос не отвеченным: как многие молекулы, включая гормоны, транспортные белки и нейротрансмиттеры, столь точно и своевременно доставляются по адресу? Первый луч света на это был пролит работами Паладе, который показал, что такие молекулы упаковываются в пузырьки, «отпочковывающиеся» от эндоплазматического ретикулума (ЭР) и сливающиеся позже с другими мембранами. Но как именно это происходит, и что управляет этим таинственным процессом, оставалось покрытым мраком.

Гены везикулярного транспорта: при чем тут дрожжи?

Рэнди Шекман (Randy W.

Schekman), изучавший биохимию под началом Артура Корнберга (лауреата Нобелевской премии в 1959 году), решил заняться механизмом молекулярного транспорта с позиций генетики и выбрал в качестве модельного объекта пекарские дрожжи (Saccharomyces cerevisiae). Шекман собрался выявить гены, которые участвуют в процессе везикулярного транспорта, с помощью мутантных форм дрожжей и анализа накапливающихся внутри клетки секреторных ферментов [1–3].

Первые два открытых гена получили названия sec1 и sec2, а более детальное сканирование выявило в сумме 23 гена [2]. Эти белки разделились на три группы, в зависимости от того, блокировался ли везикулярный транспорт на уровне ЭР, аппарата Гольджи или секреции за пределы клеточной мембраны (рис. 2).

Позже была определена последовательность событий посттрансляционной модификации, которые управляют процессом секреции [3].

Детальное генетическое и морфологическое исследование «отловило» промежуточные стадии транспорта между ЭР и аппаратом Гольджи, и особенно это было заметно на мутантах sec17 и sec18, в которых секреторные пузырьки накапливались в клетке в большом количестве [4].

Работы Шекмана заложили генетический базис и выявили ключевые регуляторные события в везикулярном транспорте.

Рисунок 2. Исследование генов везикулярного транспорта. Шекман открыл гены белков, являющихся ключевыми регуляторами везикулярного транспорта. Сравнивая «нормальные» клетки дрожжей (а) с генно-инженерными мутантами с нарушениями транспорта (б), он выявил гены, отвечающие за транспорт в различные компартменты и на поверхность клетки.

Ключевые белки везикулярного транспорта

Встречным курсом двигался Джеймс Ротман (James E. Rothman), решивший в своей стэнфордской лаборатории выявить ключевые белки (а не гены, как Шекман), работающие в системе везикулярного транспорта. Используя разработанную для этого систему, он выявил ключевые белки, вовлеченные в везикулярный транспорт.

На тот момент еще не было системы эффективной экспрессии генов в клетках животных, и использовался подход на основе заражения клеток вирусом везикулярного стоматита (VSV), вследствие чего клетка начинала производить большие количества вирусного белка VSV-G.

При этом данный белок специальным образом гликозилируется при достижении аппарата Гольджи, что позволяет точно отслеживать момент доставки «по адресу».

Ротман опубликовал несколько работ о везикулярном транспорте VSV-G в системе аппарата Гольджи [5–8] и выделил из цитоплазмы ключевые компоненты, отвечающие за этот транспорт; одним из таких белков стал N-этилмалеимид-чувствительный фактор (NSF) [9–11].

Следующим стало открытие фактора SNAP (soluble NSF-attachment protein), связывающегося с мембраной при участии NSF [12].

Знаковым событием, соединившим работы Шекмана и Ротмана, стало понимание того, что ген sec18 кодировал как раз NSF, а sec17 — SNAP [13–15] (потом было найдено соответствие и остальных генов прочим открытым Ротманом белкам).

Это открытие показало, что система везикулярного транспорта является эволюционно древней для эукариот.

Позже был открыт комплекс SNARE (SNAP Receptor) [16], три из компонентов которого — VAMP/синаптобревин, SNAP-25 и синтаксин — работают в составе единого пресинаптического комплекса и отвечают за процесс слияния мембран везикулы и синапса. При этом синаптобревин находится на везикуле, а две другие молекулы — на плазматической мембране.

Именно наличие такого «распределенного» комплекса определяет последовательность событий, приводящих к направленному слиянию везикулы с мембраной и, следовательно, регулирует терминальный этап передачи сигнала в возбудимых тканях. В экспериментах in vitro было показано, что SNARE действительно вызывает слияние мембран, причем в весьма специфическом режиме (рис. 3) [17], [18].

Ротман разобрался в работе везикулярного транспорта и слиянии мембран, а также в биохимических экспериментах показал, каким образом реализуется специфичность этих процессов.

Рисунок 3. Специфичность слияния мембран в везикулярном транспорте. Ротман открыл белковый комплекс, отвечающий за слияние мембраны везикулы с целевой мембраной. При этом везикула несет белки, специфически распознающиеся рецептором «ответной части» (комплекс SNARE), что обеспечивает доставку везикулы по нужному «адресу».

Временнóй контроль слияния везикул

Томас Зюдоф (Thomas C. Südhof) исходно работал в Германии, а потом переехал в США.

В организованной им научной группе решали задачу регуляции слияния мембранных везикул, поскольку было понятно, что это событие должно запускаться каким-то внешним сигналом, а вот каким — никто не знал.

Эта задача была подсказана процессами выброса медиаторов в синапсах или секреции инсулина в поджелудочной железе, где требуется очень точный временнóй контроль.

Зюдоф заметил, что выброс медиаторов управляется внутриклеточной концентрацией ионов кальция (Ca2+) вблизи пресинаптической мембраны. В итоге он открыл, что комплексин и синаптотагмин являются критически важными компонентами кальций-зависимого слияния мембран (рис. 4).

Рисунок 4. Ca2+-зависимое слияние мембран. Зюдоф исследовал, как сигналы передаются от одной нервной клетки к другой, и как ионы кальция регулируют этот процесс. Он открыл молекулярный механизм, «чувствующий» концентрацию кальция и превращающий этот сигнал в событие слияния везикулы с синаптической мембраной, объясняя временнóй контроль формирования и слияния везикул.

В генетических и биохимических экспериментах было показано, что у мышей, «нокаутных» по гену комплексина, нарушен выброс медиаторов из-за падения кальциевой чувствительности синаптической мембраны [19], [20], — следовательно, этот белок является регулятором слияния. Кроме того, Зюдоф открыл белок синаптотагмин-1, являющийся сенсором кальция и взаимодействующий с фосфолипидами мембран и белками SNARE в ответ на кальциевую стимуляцию [21–23].

Зюдоф внес решающий вклад в нейробиологию и клеточную биологию, показав, каким образом осуществляется временной контроль выброса медиаторов в синапсах, а также установив роль ионов кальция в этом процессе.

Везикулярный транспорт и медицина

Работы Ротмана, Шекмана и Зюдофа приподняли завесу тайны над клеточным транспортом в клетке и показали, каким образом молекулы своевременно доставляются в нужное место. Несложно догадаться, что нарушения везикулярного транспорта, учитывая его роль в жизни клетки, приводят к серьезным болезням как нервной, так и эндокринной систем.

Например, такие метаболические расстройства как диабет второго типа характеризуются нарушениями как в секреции инсулина, так и в инсулинзависимом транспорте глюкозы в мышечной и жировой тканях. Кроме того, клетки иммунитета используют везикулярный транспорт для секреции цитокинов и прочих иммунологических молекул, управляющих врожденным и приобретенным иммунитетом.

В некоторых случаях эпилепсии выявляются мутантные формы белка MUNC-18-1, открытого Зюдофом и являющегося продуктом гена sec-1, описанного Шекманом. Мутации в генах MUNC-13-4, MUNC-18-2 и синтаксина-11, также входящих в систему везикулярного транспорта, могут вызывать семейный гематофагоцитарный синдром.

При этом заболевании Т-киллеры, работающие не как положено, при встрече со своей «жертвой» инициируют реакцию гипервоспаления, иногда приводящего к смерти.

На систему везикулярного транспорта могут действовать и различные токсины: например, ботулотоксин, вырабатываемый бактерией Clostriduim botulinum, расщепляет некоторые компоненты синаптического комплекса, что приводит к блокированию выброса медиаторов, параличу и смерти.

Учитывая вышесказанное, открытия Ротмана, Шекмана и Зюдофа могут пролить свет на механизмы этих заболеваний и дать ключ к их лечению.

Написано по материалам пресс-релиза Нобелевского комитета.

  1. P. Novick, R. Schekman. (1979). Secretion and cell-surface growth are blocked in a temperature-sensitive mutant of Saccharomyces cerevisiae. Proceedings of the National Academy of Sciences. 76, 1858-1862;
  2. Peter Novick, Charles Field, Randy Schekman. (1980). Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell. 21, 205-215;
  3. Peter Novick, Susan Ferro, Randy Schekman. (1981). Order of events in the yeast secretory pathway. Cell. 25, 461-469;
  4. Chris A. Kaiser, Randy Schekman. (1990). Distinct sets of SEC genes govern transport vesicle formation and fusion early in the secretory pathway. Cell. 61, 723-733;
  5. William E. Balch, William G. Dunphy, William A. Braell, James E. Rothman. (1984). Reconstitution of the transport of protein between successive compartments of the golgi measured by the coupled incorporation of N-acetylglucosamine. Cell. 39, 405-416;
  6. William E. Balch, Benjamin S. Glick, James E. Rothman. (1984). Sequential intermediates in the pathway of intercompartmental transport in a cell-free system. Cell. 39, 525-536;
  7. William A. Braell, William E. Balch, Darrell C. Dobbertin, James E. Rothman. (1984). The glycoprotein that is transported between successive compartments of the golgi in a cell-free system resides in stacks of cisternae. Cell. 39, 511-524;
  8. E. Fries, J. E. Rothman. (1980). Transport of vesicular stomatitis virus glycoprotein in a cell-free extract.. Proceedings of the National Academy of Sciences. 77, 3870-3874;
  9. M. R. Block, B. S. Glick, C. A. Wilcox, F. T. Wieland, J. E. Rothman. (1988). Purification of an N-ethylmaleimide-sensitive protein catalyzing vesicular transport.. Proceedings of the National Academy of Sciences. 85, 7852-7856;
  10. V MALHOTRA. (1988). Role of an N-ethylmaleimide-sensitive transport component in promoting fusion of transport vesicles with cisternae of the Golgi stack. Cell. 54, 221-227;
  11. Benjamin S. Glick, James E. Rothman. (1987). Possible role for fatty acyl-coenzyme A in intracellular protein transport. Nature. 326, 309-312;
  12. Douglas O. Clary, Irene C. Griff, James E. Rothman. (1990). SNAPs, a family of NSF attachment proteins involved in intracellular membrane fusion in animals and yeast. Cell. 61, 709-721;
  13. Duncan W. Wilson, Celeste A. Wilcox, Gregory C. Flynn, Ellson Chen, Wun-Jing Kuang, et. al.. (1989). A fusion protein required for vesicle-mediated transport in both mammalian cells and yeast. Nature. 339, 355-359;
  14. K A Eakle, M Bernstein, S D Emr. (1988). Characterization of a component of the yeast secretion machinery: identification of the SEC18 gene product.. Mol. Cell. Biol.. 8, 4098-4109;
  15. Griff I.C., Schekman R., Rothman J.E., Kaiser C.A. (1992). The yeast SEC17 gene product is functionally equivalent to mammalian alpha-SNAP protein. J. Biol. Chem. 267, 12106–12115;
  16. Thomas Söllner, Sidney W. Whiteheart, Michael Brunner, Hediye Erdjument-Bromage, Scott Geromanos, et. al.. (1993). SNAP receptors implicated in vesicle targeting and fusion. Nature. 362, 318-324;
  17. Thomas Weber, Boris V Zemelman, James A McNew, Benedikt Westermann, Michael Gmachl, et. al.. (1998). SNAREpins: Minimal Machinery for Membrane Fusion. Cell. 92, 759-772;
  18. James A. McNew, Francesco Parlati, Ryouichi Fukuda, Robert J. Johnston, Keren Paz, et. al.. (2000). Compartmental specificity of cellular membrane fusion encoded in SNARE proteins. Nature. 407, 153-159;
  19. Harvey T. McMahon, Markus Missler, Cai Li, Thomas C. Südhof. (1995). Complexins: Cytosolic proteins that regulate SNAP receptor function. Cell. 83, 111-119;
  20. Kerstin Reim, Michael Mansour, Frederique Varoqueaux, Harvey T. McMahon, Thomas C. Südhof, et. al.. (2001). Complexins Regulate a Late Step in Ca2+-Dependent Neurotransmitter Release. Cell. 104, 71-81;
  21. Mark S. Perin, Victor A. Fried, Gregory A. Mignery, Reinhard Jahn, Thomas C. Südhof. (1990). Phospholipid binding by a synaptic vesicle protein homologous to the regulatory region of protein kinase C. Nature. 345, 260-263;
  22. Martin Geppert, Yukiko Goda, Robert E. Hammer, Cai Li, Thomas W. Rosahl, et. al.. (1994). Synaptotagmin I: A major Ca2+ sensor for transmitter release at a central synapse. Cell. 79, 717-727;
  23. Rafael Fernández-Chacón, Andreas Königstorfer, Stefan H. Gerber, Jesús García, Maria F. Matos, et. al.. (2001). Synaptotagmin I functions as a calcium regulator of release probability. Nature. 410, 41-49.

Источник: https://biomolecula.ru/articles/nobelevskaia-premiia-po-fiziologii-i-meditsine-2013-vezikuliarnyi-transport

Реферат: Везикулярный транспорт

Везикулярный транспорт: Гликопротеины, переносимые из шероховатого эндоплазматическо­го

АО «Медицинский университет Астана»

Кафедра биологии с курсом радиобиологии и радиационной медицины.

Реферат

По молекулярной биологии

Тема: Везикулярный транспорт

План.

  1. Введение
  2. Пути транспорта белков в клетке
  3. Сигнальные последовательности белков

Пути транспорта белков в клетке

Пути транспорта в клетке

Синтез белка всегда начинается в цитоплазме. Окончание синтеза происходит в цитоплазме либо на шероховатом эндоплазматическом ретикулуме (ШЭР). Можно условно выделить два пути транспорта белка в клетке: 1. Из цитоплазмы в некоторые органеллы (ядро, пластиды, митохондрии)

2.

Большой путь везикулярного транспорта из ШЭР через аппарат Гольджи (АГ) к другим органеллам (лизосомы, пероксисомы) и через секреторные везикулы во внеклеточную среду.

Поскольку синтез всех белков начинается в цитоплазме, а конечная локализация каждого белка может быть различна внутри полипептида имеется система сигналов определяющая его транспортный путь.

Первичный сигнал определяет путь из цитоплазмы (в ШЭР, в ядро, в митохондрию или в пластиду), вторичный сигнал определяет дальнейшее направление, например, внешняя или внутренняя мембрана митохондрии или матрикс; лизосома, пероксисома или секреторная гранула.

Сигнальные последовательности белков

Сигнальные последовательности имеют длину 3-80 аминокислот узнаются специфическими рецепторами на мембранах различных компартментов клетки. Сигнальная последовательность ЭР – гидрофобный участок 5-15 аминокислот на N-конце полипептида. Сигнал митохондриальных белков 20-80 аминокислот состоящий из спирали и торчащих концов – (+)-заряженного и гидрофобного.

5 (+)-заряженных аминокислот для транспортировки в ядро. Пероксисомные белки имеют последовательность на С-конце Ser-Lys-Leu-COOH.

Имеется класс сигнальных последовательностей которые не позволяют белку достигшему определенной локализации транспортироваться дальше.

Например, мотив Lys-Asp-Glu-Leu-COOH (KDEL) не позволяет белкам покидать эндоплазматический ретикулум.

Одна из функций гладкого ЭР – удержание кальция готового для выпуска в цитозоль при стимуляции клетки. Кальретикулин – белок удерживающий ионы кальция. Первые 17 аминокислот включают 14 гидрофобных (синие) – сигнальная последовательность для проникновения в ЭР из цитозоля. Последние четыре аминокислоты KDEL удерживают белок в ЭР.

(NH2)MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKF YGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTHEQNIDCGGGYLFP NSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRP DNTYEIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKP EDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQI DNPDYKGTWIHPEIDNPEYSPDPSIYAYDNF GVLGLDLWQSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL

KEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL(COOH)

Некоторые белки имеют различные локализации в клетки. Существует несколько путей транспортировки идентичных полипептидов в различные компартменты клетки [Karniely, 2005]: 1. Несколько сигнальных последовательностей в одном полипептиде преднозначенные для разных компартментов.

Каталаза А дрожжей имеет две сигнальные последовательности – для митохондрий и пероксисом, причем количество фермента в этих органеллах зависит от состава среды. Некоторые цитохромы имеют два сигнала – митохондриальный и ЭР. Митохондриальный сигнал запускается после посттрансляционного фосфорилирования белка.

Известно, что белок-предшественник амилоида болезни Альцгеймера также имеет два сигнала локализации – ЭР и митохондрий. 2. Одна сигнальная последовательность узнается различными рецепторами на поверхности компартментов.

Например, некоторые белки митохондрий и хлоропластов имеют общую сигнальную последовательность, которая более гидрофобна чем специфические сигналы. 3. Сигнал может быть блокирован другим белком. Апуриновая/апиримидиновая эндонуклеаза 1 (Apn1) – основной фермент эксцизионной репарации репарации ДНК в ядре и митохондриях.

С-конец имеет сигнал ядерной локализации (NLS), за которым идет сигнал митохондриальной локализации. белок Pir1 взаимодействует с С-концом Apn1 блокируя NLS. 4. Сигнал может быть блокирован специфическим сворачиванием белка.

Аденилат-киназа дрожжей Aky2 локализуется в цитоплазме и в небольшом количестве в межмембранном пространстве митохондрий, имеет две сигнальные последовательности, активность которых зависит от конформации белка. 5. Сигнал может быть блокирован после модификации полипептида.

Фосфорилированный цитохром CYP2B1, взаимодействует с цитозольным шапероном Hsp70, что приводит к конформационным изменениям и переключает одну сигнальную последовательность на другую.

6. Одна РНК может иметь два сайта инициации трансляции при этом образуются два белка – один с сигнальной последовательностью, другой без нее, что определит различную локализацию белков в клетке. В другом случае может образовываться две различные РНК кодирующие два идентичных белка, но у одного будет сигнальная последовательность, а у другого нет.

Транспорт в митохондрии и пластиды

Митохондрии и пластиды имеют собственную ДНК и самостоятельно синтезируют некоторые белки. Однако многие из основных белков митохондрий и пластид синтезируются в цитозоле. Белки проникающие в митохондрии должны нести сигнал, определяющий локализацию – внутрення или наружная мембрана, или матрикс.

Белки преднозначенные для матрикса несут сигнал на N-конце, который узнается рецепторами на внешней мембране. Рецептор связан с комплексом переноса белка, который разворачивает белок и переносит его через мембрану. После переноса белка сигнальная последовательность отрезается и белок снова сворачивается.

Белки шапероны связываются с вновь синтезированным белком предотвращая его сворачивание. Шаперонины связываются с белком после его транспортировки к месту доставки и способствуют правильному сворачиванию.

В ответ на различные стрессовые воздействия (например повышение температуры) в клетке синтезируются шапероны называемые белками теплового шока – hsp (heat-shock proteins), которые стабилизируют клеточные белки. Hsp обнаружены во всех клеточных компартментах эукариот и у бактерий.

Везикулярный транспорт

Из одной органеллы в другую перемещение происходит в везикуле или на ее поверхности в виде интегральных белков. Донорый компартмент – органелла от которой отрывается мембрана в составе везикулы, акцепторный компартмент – принимает везикулу. конститутивная секреция – происходит постоянно и не зависит от внешних сигналов.

регулируемая секреция – под ПМ происходит накопление пузырьков, которые сливаются с ПМ при наличии внешних сигналов – гормоны, нервы – и повышении конц. Ca2+ до 1мкм ретроградный транспорт – возвращение рецепторных белков и липидов из АГ в Эр – восполнение мембраны ЭР. антероградный транспорт – растворимые грузовые белки двигаются по секреторному пути ЭР.

Окаймленные везикулы – покрыты белками, кот узнают и концентрируют специфич.

м-ные белки и отделяют м-ну пузырька, формируют решетку и придают форму везикуле: клатриновые, COPI, COPII: Клатриновые везикулы – ~0,1мкм, транспорт из АГ и ПМ,клатрин – 3типа, 3 большие и 3 малые субъединицы формирующие трискелетон – собирающиеся на поверхности м-ны со стороны цитоплазмы в пента- и гексагоны, кот спонтанно формируют сферу.

Адаптин – связывает клатрин с м-ной и ловит различные трансм-ные белки в том числе грузовые рецепторы, кот. захватывают р-римые грузовые белки, кот попадают внутрь везикулы.

Имеетя по крайней мере 4 типа адаптинов динамин – GTP-аза, р-римый цитоплазматический белок, образует кольцо на отделяющейся клатриновой везикуле – регулирует кол-во клатрина отщепляющееся вместе с м-ной в составе везикулы, ассоциирует другие белки помогающие выпучить м-ну и белки модификаторы липидов, изменяющие локально липидный состав м-ны для выпучивания После отделения везикулы от м-ны клатрин и адипин отделяют шапероны – ATP-азы hsp70 семейства. Ауксилин – прикрепляется к везикуле и активирует АТФ-азу. Т.к кайма формирующейся везикулы сущ. дольше чем кайма отделенной – имеется стабилизирующий механизм. Клатриновая оболочка обеспечивает значительную силу для изгибания м-ны, т.к. везикулы из внутриклеточных компартментов образуются на уже выпученной м-не COP-I – транспорт от АГ и ЭР, 8субъединиц, GTP-белок – фактор рибозилирования АДФ –ARF – транспорт COP-II – транспорт из АГ и ЭР, 5 субъединиц Везикулы мб не только сферические, часто образуются трубчатые везикулы в которых высокое соотношение S/V Образование клатриновых и COP везикул регулируется GTP-связывающими белками, которые могут находится в активном GTP- и неактивном GDP-состоянии Два класса белков обменивают GDP-GTP: GEF-гуанин-нуклеотид-фактор обмена активирует белки заменяя GDF?GTF, GAP- белок активирующий GTP-азы – инактивирует GTP-связывающие белки меняя GTP?GDP. GTP-азы необходимые для сборки окаймленных везикул перед сборкой пузырьков: мономерные GTP-связывающие белки (GTP-азы): ARF-белки – необх для клатриновой и COP сборки на пов-ти м-ны АГ. Sar1 белок, необходим для COPII сборки на на ЭР м-не тримерные (G белки). GTP-азы находятся в цитозоле в неактивном состоянии, перед сборкой GEF встраивается в м-ну ЭР и связывает цитозольный SarI, кот обменивает GDF?GTP. В GTP состоянии SarI встраивается остатком жирной к-ты в м-ну ЭР. Ассоциирует белки об-ки и инициирует отпочковывание везикулы. GTP-азы попавшие в м-ну активируют фосфолипазу D, кот преобразует фосфолипиды в фосфотидную к-ту, что усиливает связывание оболочных белков. Вместе белок-белковые и белок-липидные взаимодействия изгибают м-ну SNARE – белки – отвечают за слияние донорной и акцепторной м-н, более 20, каждая на специфич пов-ти м-ны, трансмембранные белки на пов-ти везикулы – v-SNAR, на пов-ти донора – t-SNAR. Взаимодействуя v- и t-SNAR обвиваются др на друга в транс-SNAR-комплекс, обеспечивающий слияние м-н. SNF-белок разрушает транс-SNAR-комплексы – цитозольный шаперон ATP-аза, использует адаптирующие белки для связывания с комплексом-SNAR Rab-белки – мономерные GTP-азы, более 30, каждая органелла имеет хотя бы один Rab на м-не со стороны цитоплазмы, регулируют стыковку везикул и связывание v-SNAR-ов и t-SNAR-ов необходимых для слияния м-н. В состоянии GDP-не активны, нах в цитозоле, в состоянии GTP-активны и переходят на пов-ть м-ны органеллы или везикулы. В активном состоянии Rap связываются с м-ной липидным якорем и собирают другие белки участвующие в слиянии м-н неактивный Rab-GDP связан с GDI – GDP-диссоциирующий ингибитор. Rab-GDP связывается с GEF-гуанин нуклеотид меняющий фактор, связанный с м-ной донорного компартмента – меняет GDP на GTP. Rab-GTP связывается с м-ной формирующейся везикулы и ассоциирует v-SNARE, которые в составе везикулы транспортируются к органелле и связываются с Rab-эффекторами и t-SNARE, связанными с м-ной акцепторного компартмента и обеспечивают слияние м-н белок органелла Rab1 ЭР и АГ Rab2 цис-АГ Rab3A синаптич везикулы, секрет гранулы Rab4 ранние эндосомы Rab5A ПМ, клатриновые везикулы Rab5C ранние эндосомы Rab6 промежуточный- и транс-АГ Rab7 поздние эндосомы Rab8 секреторные везикулы (базолатеральные) Rab9 поздние эндосомы, trans-АГ

Слияние м-н происходит не только при везикулярном транспорте: слияние спермия с яйцом, слияние миобластов во время развития мышечной клетки.

Образование клатринового пузырька. Диаметр клатринового пузырька ~0,3 мкм

клатриновая везикула

Транспорт белков из аппарата Гольджи на наружную мембрану

Белки, встроившиеся в мембрану ЭПС и попавшие оттуда в составе везикул в АГ, могут перемещаться на наружную мембрану клетки. Их направление к мембране осуществляется благодаря взаимодействию везикул с микротрубочками цитоскелета и благодаря особым стыковочным белкам, которые обеспечивают слияние везикул с мембраной

Экзоцитоз и трансцитоз

Экзоцитоз есть как у эукариот, так иу прокариот. Экзоцитоз (от греч. Έξω — внешний и κύτος — клетка) у эукариот — клеточный процесс, при котором внутриклеточные везикулы (мембранные пузырьки) сливаются с наружной клеточной мембраной.

При экзоцитозе содержимое секреторных везикул (экзоцитозных пузырьков) выделяется наружу, а их мембрана сливается с клеточной мембраной. Практически все макромолекулярные соединения (белки, пептидные гормоны и др.) выделяются из клеток эукариот этим способом.

У прокариот везикулярный механизм экзоцитоза не встречается, у них экзоцитозом называют встраивание белков в клеточную мембрану (или в наружную мембрану у грамотрицательных бактерий), выделение белков из клетки во внешнюю среду или в периплазматическое пространство [4] .

Экзоцитоз может выполнять различные задачи:

  • доставка на клеточную мембрану липидов, необходимого для роста клетки;
  • доставка на клеточную мембрану мембранных белков, таких как рецепторы или белки-транспортёры. При этом часть белка, которая была направлена внутрь секреторной везикулы, оказывается выступающей на наружной поверхности клетки;
  • выделение различных веществ из клетки; это могут быть, например, непереваренные остатки пищи у фаготрофных протистов, пищеварительные ферменты у животных с полостным пищеварением, белки межклеточного вещества у животных и материал клеточной стенки у растений, сигнальные молекулы (гормоны или нейромедиаторы).

У эукариот различают два типа экзоцитоза:

  1. Кальций-независимый конститутивный экзоцитоз встречается практически во всех эукариотических клетках. Это необходимый процесс для построения внеклеточного матрикса и доставки белков на внешнюю клеточную мембрану. При этом секреторные везикулы доставляются к поверхности клетки и сливаются с наружной мембраной по мере их образования.
  2. Кальций-зависимый неконститутивный экзоцитоз встречается, например, в химических синапсах, где служит для выделения нейромедиаторов. При этом типе экзоцитоза секреторные пузырьки накапливаются в клетке, а процесс их высвобождения запускается по определённому сигналу, опосредованному быстрым повышением концентрации ионов кальция в цитозоле клетки. В пресинаптических мембранах процесс осуществляется специальным кальций-зависимым белковым комплексом [w:[SNARE|]] .

Заключение.

Подготовив работу на тему «везикулярный транспорт» я поняла, что это очень важный и сложный процесс.

Сложная организация эукариотических клеток требует налаженных механизмов внутриклеточного везикулярного транспорта.

Новейшие исследования показали, что механизмы, лежащие в основе таких функционально важных процессов как эндо- и экзоцитоз уникальны и, сохранившись в процессе эволюции, эффективно действуют как в клетке дрожжей, так и в нейроне гиппокампа.

Как эндоцитоз лиганд-рецепторного комплекса с поверхности плазматической мембраны, так и транспорт вновь синтезируемых секреторных белков из эндоплазматического ретикулума через цис-, медиал-, транс- Гольджи к поверхности плазматической мембраны осуществляются в везикулах.

Транспортные везикулы формируются и отпочковываются от донорной мембраны и после осуществления раунда внутриклеточного транспорта сливаются с акцепторной мембраной. Специализированные белки цитоплазмы покрывают вновь образованные везикулы.

Согласно современным представлениям, формирование транспортной везикулы на мембране внутриклеточного компартмента начинается после взаимодействия белков, переносимых везикулой, с трансмембранным рецептором. Изменение структурного состояния связанного рецептора может распознаваться цитоплазматическими белками, которые ассоциируются с мембраной и инициируют образование транспортной везикулы.

Используемая литература:

1. Альбертс Б., Брей Д. и др. Молекулярная биология клетки. – М., 1994.

2. Горышина Е.Н., Чага О.СЮ. Сравнительная гистология тканей внутренней среды с основными иммунологами. – Л., 1990.

3. Заварзин А.А. Основы сравнительной гистологии. – Л., 1985.

4. Балахонов А.В. Ошибки развития. – Л., 1990.

5. Гилберт С. Биология развития: в 3-х т. – М., 1993-95.

6. Светлов П.Г. Физиология (механика) развития. – Л., 1978. т.1, 2.

7. Станек И. Эмбриология человека. – Братислава, 1977.

8. Юрина Н.А., Торбек В.Э., Румянцева Л.С. Основные этапы эмбриогенеза позвоночных животных и человека. – М., 1984.

Источник: https://www.bestreferat.ru/referat-288556.html

Cell Biology.ru

Везикулярный транспорт: Гликопротеины, переносимые из шероховатого эндоплазматическо­го
Пути транспорта в клетке

Синтез белка всегда начинается в цитоплазме. Окончание синтеза происходит в цитоплазме либо на шероховатом эндоплазматическом ретикулуме (ШЭР).Можно условно выделить два пути транспорта белка в клетке:1. Из цитоплазмы в некоторые органеллы (ядро, пластиды, митохондрии)

2.

Большой путь везикулярного транспорта из ШЭР через аппарат Гольджи (АГ) к другим органеллам (лизосомы, пероксисомы) и через секреторные везикулы во внеклеточную среду.

Поскольку синтез всех белков начинается в цитоплазме, а конечная локализация каждого белка может быть различна внутри полипептида имеется система сигналов определяющая его транспортный путь.

Первичный сигнал определяет путь из цитоплазмы (в ШЭР, в ядро, в митохондрию или в пластиду), вторичный сигнал определяет дальнейшее направление, например, внешняя или внутренняя мембрана митохондрии или матрикс; лизосома, пероксисома или секреторная гранула.

Везукулярный транспорт

Из одной органеллы в другую перемещение происходит в везикуле или на ее поверхности в виде интегральных белков.

Донорый компартмент – органелла от которой отрывается мембрана в составе везикулы, акцепторный компартмент – принимает везикулу.

конститутивная секреция – происходит постоянно и не зависит от внешних сигналов.
регулируемая секреция – под ПМ происходит накопление пузырьков, которые сливаются с ПМ при наличии внешних сигналов – гормоны, нервы – и повышении конц. Ca2+ до 1мкм
ретроградный транспорт – возвращение рецепторных белков и липидов из АГ в Эр – восполнение мембраны ЭР.
антероградный транспорт – растворимые грузовые белки двигаются по секреторному пути ЭР→ пузырек?цис-Гольджи?пузырек?транс-Гольджи?пузырек?органелла или секрецияОкаймленные везикулы – покрыты белками, кот узнают и концентрируют специфич. м-ные белки и отделяют м-ну пузырька, формируют решетку и придают форму везикуле: клатриновые, COPI, COPII:Клатриновые везикулы – ~0,1мкм, транспорт из АГ и ПМ,клатрин – 3типа, 3 большие и 3 малые субъединицы формирующие трискелетон – собирающиеся на поверхности м-ны со стороны цитоплазмы в пента- и гексагоны, кот спонтанно формируют сферу. Адаптин – связывает клатрин с м-ной и ловит различные трансм-ные белки в том числе грузовые рецепторы, кот. захватывают р-римые грузовые белки, кот попадают внутрь везикулы. Имеетя по крайней мере 4 типа адаптиновдинамин – GTP-аза, р-римый цитоплазматический белок, образует кольцо на отделяющейся клатриновой везикуле – регулирует кол-во клатрина отщепляющееся вместе с м-ной в составе везикулы, ассоциирует другие белки помогающие выпучить м-ну и белки модификаторы липидов, изменяющие локально липидный состав м-ны для выпучиванияПосле отделения везикулы от м-ны клатрин и адипин отделяют шапероны – ATP-азы hsp70 семейства. Ауксилин – прикрепляется к везикуле и активирует АТФ-азу. Т.к кайма формирующейся везикулы сущ. дольше чем кайма отделенной – имеется стабилизирующий механизм. Клатриновая оболочка обеспечивает значительную силу для изгибания м-ны, т.к. везикулы из внутриклеточных компартментов образуются на уже выпученной м-неCOP-I – транспорт от АГ и ЭР, 8субъединиц, GTP-белок – фактор рибозилирования АДФ –ARF – транспортCOP-II – транспорт из АГ и ЭР, 5 субъединицВезикулы мб не только сферические, часто образуются трубчатые везикулы в которых высокое соотношение S/VОбразование клатриновых и COP везикул регулируется GTP-связывающими белками, которые могут находится в активном GTP- и неактивном GDP-состоянииДва класса белков обменивают GDP-GTP: GEF-гуанин-нуклеотид-фактор обмена активирует белки заменяя GDF?GTF, GAP- белок активирующий GTP-азы – инактивирует GTP-связывающие белки меняя GTP?GDP.GTP-азы необходимые для сборки окаймленных везикул перед сборкой пузырьков: мономерные GTP-связывающие белки (GTP-азы):ARF-белки – необх для клатриновой и COP сборки на пов-ти м-ны АГ. Sar1 белок, необходим для COPII сборки на на ЭР м-нетримерные (G белки).GTP-азы находятся в цитозоле в неактивном состоянии, перед сборкой GEF встраивается в м-ну ЭР и связывает цитозольный SarI, кот обменивает GDF?GTP. В GTP состоянии SarI встраивается остатком жирной к-ты в м-ну ЭР. Ассоциирует белки об-ки и инициирует отпочковывание везикулы. GTP-азы попавшие в м-ну активируют фосфолипазу D, кот преобразует фосфолипиды в фосфотидную к-ту, что усиливает связывание оболочных белков. Вместе белок-белковые и белок-липидные взаимодействия изгибают м-нуSNARE – белки – отвечают за слияние донорной и акцепторной м-н, более 20, каждая на специфич пов-ти м-ны, трансмембранные белки на пов-ти везикулы – v-SNAR, на пов-ти донора – t-SNAR. Взаимодействуя v- и t-SNAR обвиваются др на друга в транс-SNAR-комплекс, обеспечивающий слияние м-н. SNF-белок разрушает транс-SNAR-комплексы – цитозольный шаперон ATP-аза, использует адаптирующие белки для связывания с комплексом-SNARRab-белки – мономерные GTP-азы, более 30, каждая органелла имеет хотя бы один Rab на м-не со стороны цитоплазмы, регулируют стыковку везикул и связывание v-SNAR-ов и t-SNAR-ов необходимых для слияния м-н. В состоянии GDP-не активны, нах в цитозоле, в состоянии GTP-активны и переходят на пов-ть м-ны органеллы или везикулы. В активном состоянии Rap связываются с м-ной липидным якорем и собирают другие белки участвующие в слиянии м-ннеактивный Rab-GDP связан с GDI – GDP-диссоциирующий ингибитор. Rab-GDP связывается с GEF-гуанин нуклеотид меняющий фактор, связанный с м-ной донорного компартмента – меняет GDP на GTP. Rab-GTP связывается с м-ной формирующейся везикулы и ассоциирует v-SNARE, которые в составе везикулы транспортируются к органелле и связываются с Rab-эффекторами и t-SNARE, связанными с м-ной акцепторного компартмента и обеспечивают слияние м-нбелок органеллаRab1 ЭР и АГRab2 цис-АГRab3A синаптич везикулы, секрет гранулыRab4 ранние эндосомыRab5A ПМ, клатриновые везикулыRab5C ранние эндосомыRab6 промежуточный- и транс-АГRab7 поздние эндосомыRab8 секреторные везикулы (базолатеральные)Rab9 поздние эндосомы, trans-АГ

Слияние м-н происходит не только при везикулярном транспорте: слияние спермия с яйцом, слияние миобластов во время развития мышечной клетки.

Образование клатринового пузырька. Диаметр клатринового пузырька ~0,3 мкм
клатриновая везикула

Источник: https://cellbiol.ru/book/kletka/kletochnyj_transport/vezikulyarnyj_transport

ПОИСК

Везикулярный транспорт: Гликопротеины, переносимые из шероховатого эндоплазматическо­го

Рис. 63. Перемещение цистерн (I) и везикулярный транспорт (II) в аппарате

    Везикулярный транспорт и сохранение индивидуальности компартментов [c.82]

    Бесклеточные системы дают другой плодотворный подход к изучению молекулярных механизмов везикулярного транспорта [70] [c.84]

    По-видимому, в везикулярном транспорте определенную роль играет цитоскелет. Движение везикул с вновь синтезированными белками напоминает эндоцитоз — транспорт веществ в эндосомах (см. гл. VI).

Несмотря на то что эти процессы являются важнейшими в биогенезе мембран, основные механизмы, лежащие в их основе, остаются неизвестными.

Неясно, что заставляет везикулы отпочковываться от цистерн, как везикулы находят мембраны мишени, сортируя доставляемые белки, каков механизм слияния везикул с мембраной цистерны-мишени или мембраны органелл, куда транспортируется данный белок, что при этом происходит с липидами везикулы  [c.184]

    В настоящее время получены внеклеточные мембранные системы, в которых в присутствии АТФ удается осуществлять везикулярный транспорт между цистернами аппарата Гольджи. Тем не менее ответы на поставленные выше вопросы пока не получены. [c.184]

    Как осуществляется обмен липидов в ходе биогенеза биологических мембран Приведите экспериментальные доказательства везикулярного транспорта липидов и транспорта с помощью белков-переносчиков. [c.184]

    Сравните две альтернативные гипотезы транспорта гликопротеинов в аппарате Гольджи. Приведите экспериментальные доказательства везикулярного транспорта. Спланируйте эксперимент. позволяющий доказать перепрыгивание гликопротеинов из цис-цистерн в промежуточные цистерны. [c.184]

    Секреторный цикл состоит из следующих стадий синтез, сегрегация белка в ЭПР, внутриклеточный везикулярный транспорт, концентрирование, созревание секреторных гранул, экзоцитоз, рециклизация мембран и гранул. Экзоцитоз протекает различно в клетках со спонтанной и постоянной секрецией и в клетках с регулируемой внешними стимулами секреций [c.65]

    Модель везикулярного транспорта [c.118]     Везикулярный транспорт по конститутивному пути между стопками Г ольджи и наружу, к плазматической мембране, осуществляется, по-видимому, в везикулах, не покрытых клатрином. Особенность такого вида транспорта, называемого объемным, заключается в том, что содержимое аппарата Г ольджи не концентрируете в везикулах. Зная, что транспорт в везикулах, покрытых клатрином, связан со значительным концентрированием веществ, вн сомневаетесь в том, что при объемной конститутивной секреции ж происходит концентрирования. [c.126]

    A. Неправильно. Цитоскелет выполняет гораздо менее специфические функции. Специфичность же везикулярного транспорта обеспечивается в основном рецепторами, находящимися на наружной поверхности самих везикул. [c.363]

    В. Результаты, приведенные в табл. 8-2, подтверждают модель везикулярного транспорта, поскольку почти к половине молекул меченого G-белка присоединялась галактоза.

Такая величина связывания достаточно неожиданна, поскольку она указывает на то, что как только везикула отделяется от цистерны, ее шансы слиться с цистерной в той же или в другой стопке Гольджи практически одинаковы.

В ряде других контрольных опытов было показано, что морфология стопок Гольджи не изменялась при слиянии, стопки Гольджи мутантного и дикого типа оставались отделенными друг от друга и G-белок действительно перемещался в стопку Гольджи дикого типа. [c.377]

Рис. 8.L Известные (сплошная линия) и возможные (штрихи) пути везикулярного транспорта в клетках растений

    Рис 8-10 В процессе везикулярного транспорта сохраняется расположение сторон мембран Обратите внимание, что в мембране компартмент а-мишени сохраняется исходная ориентация как белков, таки липидов, а растворимые материалы переносятся из просвета в просвет [c.13]

    Белки могут выводиться из клетки в процессе экзоцитоза, либо по конститутивной, либо по регулируемой схеме.

При регулируемом механизме молекулы сохраняются в секреторных пузырьках, которые не сливаются с плазматической мембраной и не высвобождают свое содержимое, пока не будет получен внеклеточный сигнал. Упаковка белков в эти пузырьки в транс-сети Гольджи сопровождается их избирательной конденсацией.

Регулируемая секреция происходит только в специализированных секреторных клетках, тогда как конститутивный секреторный механизм существует во всех клетках. Основной путь конститутивной секреции – везикулярный транспорт от транс-сети Гольджи к плазматической мембране.

Для неполяризованных клеток доказано, что те белки, которые не предназначены специально для транспорта в какую-либо органеллу и не имеют сигналов сортировки, удерживающих их в данной [c.81]

    Везикулярный транспорт обеспечивает перенос крупных молекул и частиц через клеточную мембрану. Эндоцитоз — перенос внутрь клетки. Экзоцитоз — перенос из клетки во внешнюю среду (различные виды секреции).

Эндоцитоз делят на два типа фагоцитоз (поглощение частиц макрофагами и гранулоцитами) и пиноцитоз (поглощение жидкостей и растворенных компонентов любыми клетками). Пиноцитоз бывает неизбирательный и селективный рецеп-торно опосредованный.

Вещества, высвобождаемые путем экзоци-тоза, делят на три группы I) вещества, связывающиеся с клеточной поверхностью как периферические белки, — антигены 2) вещества, включающиеся во внеклеточный матрикс, — коллаген, гликозамин-гликаны 3) вещества, входящие во внеклеточную среду как сигнальные молекулы (инсулин, катехоламины, паратгормон) или ферменты (экзокринных желез, эктоферменты). [c.104]

    Используя температурочувствительные мутанты дрожжей, легко клонировать гены этого организма, ответственные за транспорт. Такой подход чрезвычайно плодотворен, т. к. позволяет напрямую выявить главные белки транспортного механизма, не зная даже, как происходит секреция. Один из дрожжевых генов, отвечающих за секрецию, который был выявлен таким образом – это ген se 4. Полагают, что он кодирует GTP-связывающий белок из семейства ras (см. разд. 12.3.11 и 13.4.6). Биохимические эксперименты на клетках млекопитающих свидетельствуют о ТОМ- что сходный GTP-связываюший белок участвует в везикулярном транспорте и у высщих эукариот Возможно, он регулирует раздевание неклатриновых окаймленных пузырьков перед их связыванием с мембранами. [c.84]

    Чтобы понять молекулярные механизмы, лежащие в основе потока веществ между мембранными комиартментами, надо выявить основные рабочие части транспортных пузырьков.

Каким образом транспортные пузырьки отпочковываются от мембраны Что направляет их к мембранам-мищепям Как они сливаются с мембранами Кроме только что описанных генетических экспериментов для ответа на эти вопросы были использованы опыты по реконструкции везикулярного транспорта в бесклеточной системе. Впервые этого удалось добиться для стопки Г ольджи. Когда выделенные стопки Г ольджи инкубировали [c.84]

    До недавнего времени существовали две конкурирующие модел движения веществ через аппарат Гольджи (рис. 8-17). Согласи модели образования цистерн, новые цистерны возникают непр рывно, отщнуровываясь, как везикулы, от места соединения с Э на г/мс-стороне аппарата Гольджи.

Каждая вновь образованна цистерна движется по стопке (параллельно протекают процесс модификации содержащихся в ней веществ) и в конце концо разбивается на более мелкие, транспортные везикулы на друго стороне аппарата Гольджи.

Согласно другой модели-модел везикулярного транспорта – цистерны, раз возникнув, существуй постоянно, а созревающие гликопротеины движутся от цистерн в г/мс-стороне к цистернам на транс-стороне, будучи заключенным в мелкие транспортные везикулы. [c.118]

    Орлов B. . Механизмы везикулярного транспорта (теорегико-экспе-риментальные и практические аспекты). — М. Изд-во РУДН, 1995. – 140 с. [c.138]

    Чтобы понять общие пришщпы работы сигналов сортировки, важно различать два совершенно различных пути, по которьш белки перемещаются из одного компартмента в другой. Во-первых, они мог т непосредственно проникать через мембрану, попадая из пространства, топологически эквивалентного цитозолю, в пространство, топологически эквивалентное внеклеточному, или наоборот.

Этот путь требует наличия в мембране специального белка-транслокатора, кроме того, молекула транспортируемого белка должна развернуться, чтобы, подобно змее, проползти сквозь мембрану. В качестве примера такого рода событий может служить перемещение определенных белков из цитозоля в просвет ЭР. Второй путь передвижения белковых молекул опосредован транспортными пузырьками.

Эти пузырьки захватывают определенные молекулы в полости одного компартмента (от которого они отшнуровываются) и переносят их в другой компартмент, сливаясь с ним. Именно так происходит перенос растворимых белков из ЭР к аппарату Гольджи (см. рис. 8-Ю).

При таком везикулярном транспорте белки не пересекают никаких мембран, поэтому они переносятся только между компартментами, топологически эквивалентными друг другу. [c.14]

Смотреть страницы где упоминается термин Везикулярный транспорт: [c.309]    [c.587]    [c.413]    [c.14]    [c.18]    [c.72]    [c.85]    [c.85]    [c.86]    [c.133]    [c.133]    [c.413]    [c.10]    [c.18]    [c.72]    Молекулярная биология клетки Сборник задач (1994) — [ c.123 , c.124 , c.125 ]

© 2019 chem21.info Реклама на сайте

Источник: https://www.chem21.info/info/1413171/

Medic-studio
Добавить комментарий